NODAL monoclonal antibody (M04), clone 5H3
  • NODAL monoclonal antibody (M04), clone 5H3

NODAL monoclonal antibody (M04), clone 5H3

Ref: AB-H00004838-M04
NODAL monoclonal antibody (M04), clone 5H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NODAL.
Información adicional
Size 100 ug
Gene Name NODAL
Gene Alias MGC138230
Gene Description nodal homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4838
Clone Number 5H3
Iso type IgG2a Kappa

Enviar uma mensagem


NODAL monoclonal antibody (M04), clone 5H3

NODAL monoclonal antibody (M04), clone 5H3