NMT1 purified MaxPab mouse polyclonal antibody (B01P)
  • NMT1 purified MaxPab mouse polyclonal antibody (B01P)

NMT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004836-B01P
NMT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NMT1 protein.
Información adicional
Size 50 ug
Gene Name NMT1
Gene Alias NMT
Gene Description N-myristoyltransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMT1 (NP_066565.1, 1 a.a. ~ 496 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4836

Enviar uma mensagem


NMT1 purified MaxPab mouse polyclonal antibody (B01P)

NMT1 purified MaxPab mouse polyclonal antibody (B01P)