NME4 monoclonal antibody (M02), clone 4B6
  • NME4 monoclonal antibody (M02), clone 4B6

NME4 monoclonal antibody (M02), clone 4B6

Ref: AB-H00004833-M02
NME4 monoclonal antibody (M02), clone 4B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NME4.
Información adicional
Size 100 ug
Gene Name NME4
Gene Alias NDPK-D|NM23H4|nm23-H4
Gene Description non-metastatic cells 4, protein expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME4 (NP_005000.1, 99 a.a. ~ 187 a.a) partial recombinant protein with GST-pstS1 tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4833
Clone Number 4B6
Iso type IgG2b Kappa

Enviar uma mensagem


NME4 monoclonal antibody (M02), clone 4B6

NME4 monoclonal antibody (M02), clone 4B6