NME3 purified MaxPab mouse polyclonal antibody (B01P)
  • NME3 purified MaxPab mouse polyclonal antibody (B01P)

NME3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004832-B01P
NME3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NME3 protein.
Información adicional
Size 50 ug
Gene Name NME3
Gene Alias DR-nm23|KIAA0516|NDPK-C|NDPKC|NM23-H3|c371H6.2
Gene Description non-metastatic cells 3, protein expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NME3 (NP_002504.2, 1 a.a. ~ 169 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4832

Enviar uma mensagem


NME3 purified MaxPab mouse polyclonal antibody (B01P)

NME3 purified MaxPab mouse polyclonal antibody (B01P)