NME2 monoclonal antibody (M08A), clone 1F2
  • NME2 monoclonal antibody (M08A), clone 1F2

NME2 monoclonal antibody (M08A), clone 1F2

Ref: AB-H00004831-M08A
NME2 monoclonal antibody (M08A), clone 1F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NME2.
Información adicional
Size 200 uL
Gene Name NME2
Gene Alias MGC111212|NDPK-B|NDPKB|NM23-H2|NM23B|puf
Gene Description non-metastatic cells 2, protein (NM23B) expressed in
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4831
Clone Number 1F2
Iso type IgG3 Kappa

Enviar uma mensagem


NME2 monoclonal antibody (M08A), clone 1F2

NME2 monoclonal antibody (M08A), clone 1F2