NKX3-1 monoclonal antibody (M03), clone 3C1
  • NKX3-1 monoclonal antibody (M03), clone 3C1

NKX3-1 monoclonal antibody (M03), clone 3C1

Ref: AB-H00004824-M03
NKX3-1 monoclonal antibody (M03), clone 3C1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NKX3-1.
Información adicional
Size 100 ug
Gene Name NKX3-1
Gene Alias BAPX2|NKX3|NKX3.1|NKX3A
Gene Description NK3 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NKX3-1 (NP_006158, 100 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4824
Clone Number 3C1
Iso type IgG2b Kappa

Enviar uma mensagem


NKX3-1 monoclonal antibody (M03), clone 3C1

NKX3-1 monoclonal antibody (M03), clone 3C1