NIT1 monoclonal antibody (M01), clone 1C3
  • NIT1 monoclonal antibody (M01), clone 1C3

NIT1 monoclonal antibody (M01), clone 1C3

Ref: AB-H00004817-M01
NIT1 monoclonal antibody (M01), clone 1C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NIT1.
Información adicional
Size 100 ug
Gene Name NIT1
Gene Alias MGC57670
Gene Description nitrilase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq AFGSITGPAHWEVLLRARAIETQCYVVAAAQCGRHHEKRASYGHSMVVDPWGTVVARCSEGPGLCLARIDLNYLRQLRRHLPVFQHRRPDLYGNLGHPLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NIT1 (NP_005591.1, 228 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4817
Clone Number 1C3
Iso type IgG1 Kappa

Enviar uma mensagem


NIT1 monoclonal antibody (M01), clone 1C3

NIT1 monoclonal antibody (M01), clone 1C3