NHP2L1 monoclonal antibody (M02), clone 5C5
  • NHP2L1 monoclonal antibody (M02), clone 5C5

NHP2L1 monoclonal antibody (M02), clone 5C5

Ref: AB-H00004809-M02
NHP2L1 monoclonal antibody (M02), clone 5C5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NHP2L1.
Información adicional
Size 100 ug
Gene Name NHP2L1
Gene Alias 15.5K|FA-1|FA1|NHPX|OTK27|SNRNP15-5|SNU13|SPAG12|SSFA1
Gene Description NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NHP2L1 (AAH05358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4809
Clone Number 5C5
Iso type IgG1 Kappa

Enviar uma mensagem


NHP2L1 monoclonal antibody (M02), clone 5C5

NHP2L1 monoclonal antibody (M02), clone 5C5