NHLH1 purified MaxPab mouse polyclonal antibody (B01P)
  • NHLH1 purified MaxPab mouse polyclonal antibody (B01P)

NHLH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004807-B01P
NHLH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NHLH1 protein.
Información adicional
Size 50 ug
Gene Name NHLH1
Gene Alias HEN1|NSCL|NSCL1|bHLHa35
Gene Description nescient helix loop helix 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NHLH1 (NP_005589.1, 1 a.a. ~ 133 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4807

Enviar uma mensagem


NHLH1 purified MaxPab mouse polyclonal antibody (B01P)

NHLH1 purified MaxPab mouse polyclonal antibody (B01P)