NGFR monoclonal antibody (M04), clone 3F2
  • NGFR monoclonal antibody (M04), clone 3F2

NGFR monoclonal antibody (M04), clone 3F2

Ref: AB-H00004804-M04
NGFR monoclonal antibody (M04), clone 3F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NGFR.
Información adicional
Size 100 ug
Gene Name NGFR
Gene Alias CD271|Gp80-LNGFR|TNFRSF16|p75(NTR)|p75NTR
Gene Description nerve growth factor receptor (TNFR superfamily, member 16)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq EPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEEGGGGS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NGFR (AAH50309.1, 65 a.a. ~ 148 a.a) partial recombinant protein with mouse IgG2a-Fc tag.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4804
Clone Number 3F2
Iso type IgG1 Kappa

Enviar uma mensagem


NGFR monoclonal antibody (M04), clone 3F2

NGFR monoclonal antibody (M04), clone 3F2