NFYC purified MaxPab rabbit polyclonal antibody (D01P)
  • NFYC purified MaxPab rabbit polyclonal antibody (D01P)

NFYC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004802-D01P
NFYC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NFYC protein.
Información adicional
Size 100 ug
Gene Name NFYC
Gene Alias CBF-C|CBFC|DKFZp667G242|FLJ45775|H1TF2A|HAP5|HSM|NF-YC
Gene Description nuclear transcription factor Y, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NFYC (NP_055038.2, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4802

Enviar uma mensagem


NFYC purified MaxPab rabbit polyclonal antibody (D01P)

NFYC purified MaxPab rabbit polyclonal antibody (D01P)