NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)

NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004796-D01P
NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NFKBIL2 protein.
Información adicional
Size 100 ug
Gene Name NFKBIL2
Gene Alias FLJ40087|IKBR
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRTRLYLNLGLTFESLQQTALCNDYFRKSIFLAEQNHLYEDLFRARYNLGTIHWRAGQHSQAMRCLEGARECAHTMRKRFMESECCVVIAQVLQDLGDFLAAKRALKKAYRLGSQKPVQRAAICQNLQHVLAVVRLQQQLEEAEGRDPQGAMVICEQLGDLFSKAGDFPRAAEAYQKQLRFAELLDRPGAERAIIHVSLATTLGDMKDHHGAVRHYEEELRLRSGNVLEEAKTWLNIALSREEAGDAYELLAPCF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NFKBIL2 (AAH08782.1, 1 a.a. ~ 1219 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4796

Enviar uma mensagem


NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)

NFKBIL2 purified MaxPab rabbit polyclonal antibody (D01P)