NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)

NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004790-D01P
NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NFKB1 protein.
Información adicional
Size 100 ug
Gene Name NFKB1
Gene Alias DKFZp686C01211|EBP-1|KBF1|MGC54151|NF-kappa-B|NFKB-p105|NFKB-p50|p105|p50
Gene Description nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NFKB1 (AAH51765.1, 1 a.a. ~ 969 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4790

Enviar uma mensagem


NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)

NFKB1 purified MaxPab rabbit polyclonal antibody (D01P)