NFIC monoclonal antibody (M03), clone 1D6
  • NFIC monoclonal antibody (M03), clone 1D6

NFIC monoclonal antibody (M03), clone 1D6

Ref: AB-H00004782-M03
NFIC monoclonal antibody (M03), clone 1D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NFIC.
Información adicional
Size 50 ug
Gene Name NFIC
Gene Alias CTF|CTF5|MGC20153|NF-I|NFI
Gene Description nuclear factor I/C (CCAAT-binding transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFIC (NP_005588, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4782
Clone Number 1D6
Iso type IgG1 Kappa

Enviar uma mensagem


NFIC monoclonal antibody (M03), clone 1D6

NFIC monoclonal antibody (M03), clone 1D6