NFIC monoclonal antibody (M02A), clone 2C3
  • NFIC monoclonal antibody (M02A), clone 2C3

NFIC monoclonal antibody (M02A), clone 2C3

Ref: AB-H00004782-M02A
NFIC monoclonal antibody (M02A), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NFIC.
Información adicional
Size 200 uL
Gene Name NFIC
Gene Alias CTF|CTF5|MGC20153|NF-I|NFI
Gene Description nuclear factor I/C (CCAAT-binding transcription factor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq TEDMEGGISSPVKKTEMDKSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSILPQTASTYFPHTAIRYPPHLNPQDPLKDLVSLACDPASQQPGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFIC (NP_005588, 314 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4782
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


NFIC monoclonal antibody (M02A), clone 2C3

NFIC monoclonal antibody (M02A), clone 2C3