NFATC3 monoclonal antibody (M02), clone 3A12
  • NFATC3 monoclonal antibody (M02), clone 3A12

NFATC3 monoclonal antibody (M02), clone 3A12

Ref: AB-H00004775-M02
NFATC3 monoclonal antibody (M02), clone 3A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NFATC3.
Información adicional
Size 100 ug
Gene Name NFATC3
Gene Alias NFAT4|NFATX
Gene Description nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFATC3 (NP_775188, 70 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4775
Clone Number 3A12
Iso type IgG2b Kappa

Enviar uma mensagem


NFATC3 monoclonal antibody (M02), clone 3A12

NFATC3 monoclonal antibody (M02), clone 3A12