NEUROD1 MaxPab rabbit polyclonal antibody (D01)
  • NEUROD1 MaxPab rabbit polyclonal antibody (D01)

NEUROD1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004760-D01
NEUROD1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NEUROD1 protein.
Información adicional
Size 100 uL
Gene Name NEUROD1
Gene Alias BETA2|BHF-1|NEUROD|bHLHa3
Gene Description neurogenic differentiation 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEUROD1 (NP_002491.2, 1 a.a. ~ 356 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4760

Enviar uma mensagem


NEUROD1 MaxPab rabbit polyclonal antibody (D01)

NEUROD1 MaxPab rabbit polyclonal antibody (D01)