NEU2 monoclonal antibody (M04), clone 2E5
  • NEU2 monoclonal antibody (M04), clone 2E5

NEU2 monoclonal antibody (M04), clone 2E5

Ref: AB-H00004759-M04
NEU2 monoclonal antibody (M04), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEU2.
Información adicional
Size 100 ug
Gene Name NEU2
Gene Alias MGC129579|SIAL2
Gene Description sialidase 2 (cytosolic sialidase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4759
Clone Number 2E5
Iso type IgG2a Lambda

Enviar uma mensagem


NEU2 monoclonal antibody (M04), clone 2E5

NEU2 monoclonal antibody (M04), clone 2E5