NELL2 monoclonal antibody (M04), clone 1F6
  • NELL2 monoclonal antibody (M04), clone 1F6

NELL2 monoclonal antibody (M04), clone 1F6

Ref: AB-H00004753-M04
NELL2 monoclonal antibody (M04), clone 1F6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NELL2.
Información adicional
Size 100 ug
Gene Name NELL2
Gene Alias NRP2
Gene Description NEL-like 2 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NELL2 (NP_006150.1, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4753
Clone Number 1F6
Iso type IgG2b Kappa

Enviar uma mensagem


NELL2 monoclonal antibody (M04), clone 1F6

NELL2 monoclonal antibody (M04), clone 1F6