NEK3 monoclonal antibody (M01), clone 2F8
  • NEK3 monoclonal antibody (M01), clone 2F8

NEK3 monoclonal antibody (M01), clone 2F8

Ref: AB-H00004752-M01
NEK3 monoclonal antibody (M01), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NEK3.
Información adicional
Size 100 ug
Gene Name NEK3
Gene Alias HSPK36|MGC29949
Gene Description NIMA (never in mitosis gene a)-related kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QWLKETPDTLLNILKNADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDWVSELKKRAGWQGLCDR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NEK3 (AAH19916, 406 a.a. ~ 506 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4752
Clone Number 2F8
Iso type IgG1 Kappa

Enviar uma mensagem


NEK3 monoclonal antibody (M01), clone 2F8

NEK3 monoclonal antibody (M01), clone 2F8