NEK3 purified MaxPab mouse polyclonal antibody (B01P)
  • NEK3 purified MaxPab mouse polyclonal antibody (B01P)

NEK3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004752-B01P
NEK3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NEK3 protein.
Información adicional
Size 50 ug
Gene Name NEK3
Gene Alias HSPK36|MGC29949
Gene Description NIMA (never in mitosis gene a)-related kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEK3 (NP_002489.1, 1 a.a. ~ 506 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4752

Enviar uma mensagem


NEK3 purified MaxPab mouse polyclonal antibody (B01P)

NEK3 purified MaxPab mouse polyclonal antibody (B01P)