NEK2 MaxPab rabbit polyclonal antibody (D01)
  • NEK2 MaxPab rabbit polyclonal antibody (D01)

NEK2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004751-D01
NEK2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NEK2 protein.
Información adicional
Size 100 uL
Gene Name NEK2
Gene Alias HsPK21|NEK2A|NLK1
Gene Description NIMA (never in mitosis gene a)-related kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEK2 (NP_002488.1, 1 a.a. ~ 445 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4751

Enviar uma mensagem


NEK2 MaxPab rabbit polyclonal antibody (D01)

NEK2 MaxPab rabbit polyclonal antibody (D01)