NELL1 polyclonal antibody (A01)
  • NELL1 polyclonal antibody (A01)

NELL1 polyclonal antibody (A01)

Ref: AB-H00004745-A01
NELL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NELL1.
Información adicional
Size 50 uL
Gene Name NELL1
Gene Alias FLJ45906|IDH3GL|NRP1
Gene Description NEL-like 1 (chicken)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4745

Enviar uma mensagem


NELL1 polyclonal antibody (A01)

NELL1 polyclonal antibody (A01)