NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)
  • NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)

NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004739-D01P
NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NEDD9 protein.
Información adicional
Size 100 ug
Gene Name NEDD9
Gene Alias CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1
Gene Description neural precursor cell expressed, developmentally down-regulated 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKDYDFPPPMRQAGRPDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NEDD9 (NP_006394.1, 1 a.a. ~ 834 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4739

Enviar uma mensagem


NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)

NEDD9 purified MaxPab rabbit polyclonal antibody (D01P)