NDUFV3 polyclonal antibody (A01)
  • NDUFV3 polyclonal antibody (A01)

NDUFV3 polyclonal antibody (A01)

Ref: AB-H00004731-A01
NDUFV3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDUFV3.
Información adicional
Size 50 uL
Gene Name NDUFV3
Gene Alias CI-9KD
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKNVVEPKERGKLLATQTAAELSKNLSSPSSYPPAVNKGRKVASPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFV3 (NP_077718, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4731

Enviar uma mensagem


NDUFV3 polyclonal antibody (A01)

NDUFV3 polyclonal antibody (A01)