NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)
  • NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004729-B01P
NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFV2 protein.
Información adicional
Size 50 ug
Gene Name NDUFV2
Gene Alias -
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFV2 (NP_066552.1, 1 a.a. ~ 249 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4729

Enviar uma mensagem


NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)