NDUFS4 monoclonal antibody (M03), clone 3F11
  • NDUFS4 monoclonal antibody (M03), clone 3F11

NDUFS4 monoclonal antibody (M03), clone 3F11

Ref: AB-H00004724-M03
NDUFS4 monoclonal antibody (M03), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFS4.
Información adicional
Size 100 ug
Gene Name NDUFS4
Gene Alias AQDQ
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4724
Clone Number 3F11
Iso type IgG2a Kappa

Enviar uma mensagem


NDUFS4 monoclonal antibody (M03), clone 3F11

NDUFS4 monoclonal antibody (M03), clone 3F11