NDUFV1 monoclonal antibody (M01), clone 4A7
  • NDUFV1 monoclonal antibody (M01), clone 4A7

NDUFV1 monoclonal antibody (M01), clone 4A7

Ref: AB-H00004723-M01
NDUFV1 monoclonal antibody (M01), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFV1.
Información adicional
Size 100 ug
Gene Name NDUFV1
Gene Alias CI-51kD|UQOR1
Gene Description NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4723
Clone Number 4A7
Iso type IgG2b Kappa

Enviar uma mensagem


NDUFV1 monoclonal antibody (M01), clone 4A7

NDUFV1 monoclonal antibody (M01), clone 4A7