NDUFS3 MaxPab mouse polyclonal antibody (B01P)
  • NDUFS3 MaxPab mouse polyclonal antibody (B01P)

NDUFS3 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004722-B01P
NDUFS3 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFS3 protein.
Información adicional
Size 50 ug
Gene Name NDUFS3
Gene Alias -
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFS3 (NP_004542.1, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4722

Enviar uma mensagem


NDUFS3 MaxPab mouse polyclonal antibody (B01P)

NDUFS3 MaxPab mouse polyclonal antibody (B01P)