NDUFS3 polyclonal antibody (A01)
  • NDUFS3 polyclonal antibody (A01)

NDUFS3 polyclonal antibody (A01)

Ref: AB-H00004722-A01
NDUFS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDUFS3.
Información adicional
Size 50 uL
Gene Name NDUFS3
Gene Alias -
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFS3 (NP_004542, 155 a.a. ~ 264 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4722

Enviar uma mensagem


NDUFS3 polyclonal antibody (A01)

NDUFS3 polyclonal antibody (A01)