NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004719-D01P
NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFS1 protein.
Información adicional
Size 100 ug
Gene Name NDUFS1
Gene Alias CI-75Kd|MGC26839|PRO1304
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFS1 (NP_004997.4, 1 a.a. ~ 727 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4719

Enviar uma mensagem


NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFS1 purified MaxPab rabbit polyclonal antibody (D01P)