NDUFS1 polyclonal antibody (A01)
  • NDUFS1 polyclonal antibody (A01)

NDUFS1 polyclonal antibody (A01)

Ref: AB-H00004719-A01
NDUFS1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NDUFS1.
Información adicional
Size 50 uL
Gene Name NDUFS1
Gene Alias CI-75Kd|MGC26839|PRO1304
Gene Description NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTAQPWETRKTESIDVMD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFS1 (AAH30833, 1 a.a. ~ 727 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4719

Enviar uma mensagem


NDUFS1 polyclonal antibody (A01)

NDUFS1 polyclonal antibody (A01)