NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004713-D01P
NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFB7 protein.
Información adicional
Size 100 ug
Gene Name NDUFB7
Gene Alias B18|CI-B18|MGC2480
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFB7 (NP_004137.2, 1 a.a. ~ 137 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4713

Enviar uma mensagem


NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFB7 purified MaxPab rabbit polyclonal antibody (D01P)