AB-H00004711-M01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | NDUFB5 |
Gene Alias | CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH |
Gene Description | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr,WB-Re,ELISA |
Immunogen Prot. Seq | QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 4711 |
Clone Number | 5G5 |
Iso type | IgG1 Kappa |