View larger
Mouse monoclonal antibody raised against a partial recombinant NDUFB5.
AB-H00004711-M01
New product
NDUFB5 monoclonal antibody (M01), clone 5G5
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | NDUFB5 |
| Gene Alias | CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH |
| Gene Description | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4711 |
| Clone Number | 5G5 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant NDUFB5.