NDUFB5 polyclonal antibody (A01)
  • NDUFB5 polyclonal antibody (A01)

NDUFB5 polyclonal antibody (A01)

Ref: AB-H00004711-A01
NDUFB5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NDUFB5.
Información adicional
Size 50 uL
Gene Name NDUFB5
Gene Alias CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4711

Enviar uma mensagem


NDUFB5 polyclonal antibody (A01)

NDUFB5 polyclonal antibody (A01)