NDUFB3 monoclonal antibody (M01), clone 6C6
  • NDUFB3 monoclonal antibody (M01), clone 6C6

NDUFB3 monoclonal antibody (M01), clone 6C6

Ref: AB-H00004709-M01
NDUFB3 monoclonal antibody (M01), clone 6C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFB3.
Información adicional
Size 100 ug
Gene Name NDUFB3
Gene Alias B12
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFB3 (NP_002482, 13 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4709
Clone Number 6C6
Iso type IgG2a Kappa

Enviar uma mensagem


NDUFB3 monoclonal antibody (M01), clone 6C6

NDUFB3 monoclonal antibody (M01), clone 6C6