NDUFA8 monoclonal antibody (M05), clone 2E10
  • NDUFA8 monoclonal antibody (M05), clone 2E10

NDUFA8 monoclonal antibody (M05), clone 2E10

Ref: AB-H00004702-M05
NDUFA8 monoclonal antibody (M05), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NDUFA8.
Información adicional
Size 100 ug
Gene Name NDUFA8
Gene Alias CI-19KD|CI-PGIV|MGC793|PGIV
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA8 (NP_055037.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4702
Clone Number 2E10
Iso type IgG2a Kappa

Enviar uma mensagem


NDUFA8 monoclonal antibody (M05), clone 2E10

NDUFA8 monoclonal antibody (M05), clone 2E10