NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)
  • NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)

NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004702-B01P
NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFA8 protein.
Información adicional
Size 50 ug
Gene Name NDUFA8
Gene Alias CI-19KD|CI-PGIV|MGC793|PGIV
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA8 (NP_055037.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4702

Enviar uma mensagem


NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)

NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)