NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)
  • NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004698-D01P
NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDUFA5 protein.
Información adicional
Size 100 ug
Gene Name NDUFA5
Gene Alias B13|CI-13KD-B|DKFZp781K1356|FLJ12147|NUFM|UQOR13
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4698

Enviar uma mensagem


NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)

NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)