NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)
  • NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)

NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004696-B01P
NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDUFA3 protein.
Información adicional
Size 50 ug
Gene Name NDUFA3
Gene Alias B9
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDUFA3 (NP_004533.1, 1 a.a. ~ 84 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4696

Enviar uma mensagem


NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)

NDUFA3 purified MaxPab mouse polyclonal antibody (B01P)