NDUFA1 monoclonal antibody (M10), clone 2A4
  • NDUFA1 monoclonal antibody (M10), clone 2A4

NDUFA1 monoclonal antibody (M10), clone 2A4

Ref: AB-H00004694-M10
NDUFA1 monoclonal antibody (M10), clone 2A4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NDUFA1.
Información adicional
Size 100 ug
Gene Name NDUFA1
Gene Alias CI-MWFE|MWFE|ZNF183
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDUFA1 (AAH00266, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4694
Clone Number 2A4
Iso type IgG2a Kappa

Enviar uma mensagem


NDUFA1 monoclonal antibody (M10), clone 2A4

NDUFA1 monoclonal antibody (M10), clone 2A4