NDN monoclonal antibody (M15), clone 2G8
  • NDN monoclonal antibody (M15), clone 2G8

NDN monoclonal antibody (M15), clone 2G8

Ref: AB-H00004692-M15
NDN monoclonal antibody (M15), clone 2G8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NDN.
Información adicional
Size 100 ug
Gene Name NDN
Gene Alias HsT16328|PWCR
Gene Description necdin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,ELISA
Immunogen Prot. Seq AHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NDN (NP_002478, 102 a.a. ~ 183 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4692
Clone Number 2G8
Iso type IgG2b Kappa

Enviar uma mensagem


NDN monoclonal antibody (M15), clone 2G8

NDN monoclonal antibody (M15), clone 2G8