NDN purified MaxPab rabbit polyclonal antibody (D01P)
  • NDN purified MaxPab rabbit polyclonal antibody (D01P)

NDN purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004692-D01P
NDN purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NDN protein.
Información adicional
Size 100 ug
Gene Name NDN
Gene Alias HsT16328|PWCR
Gene Description necdin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDN (NP_002478.1, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4692

Enviar uma mensagem


NDN purified MaxPab rabbit polyclonal antibody (D01P)

NDN purified MaxPab rabbit polyclonal antibody (D01P)