NDN MaxPab mouse polyclonal antibody (B01P)
  • NDN MaxPab mouse polyclonal antibody (B01P)

NDN MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004692-B01P
NDN MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NDN protein.
Información adicional
Size 50 ug
Gene Name NDN
Gene Alias HsT16328|PWCR
Gene Description necdin homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NDN (NP_002478, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4692

Enviar uma mensagem


NDN MaxPab mouse polyclonal antibody (B01P)

NDN MaxPab mouse polyclonal antibody (B01P)