NCAM2 polyclonal antibody (A01)
  • NCAM2 polyclonal antibody (A01)

NCAM2 polyclonal antibody (A01)

Ref: AB-H00004685-A01
NCAM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NCAM2.
Información adicional
Size 50 uL
Gene Name NCAM2
Gene Alias MGC51008|NCAM21
Gene Description neural cell adhesion molecule 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NCAM2 (NP_004531, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4685

Enviar uma mensagem


NCAM2 polyclonal antibody (A01)

NCAM2 polyclonal antibody (A01)