NUBP1 monoclonal antibody (M03), clone 2B11
  • NUBP1 monoclonal antibody (M03), clone 2B11

NUBP1 monoclonal antibody (M03), clone 2B11

Ref: AB-H00004682-M03
NUBP1 monoclonal antibody (M03), clone 2B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NUBP1.
Información adicional
Size 100 ug
Gene Name NUBP1
Gene Alias MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene Description nucleotide binding protein 1 (MinD homolog, E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NUBP1 (NP_002475.1, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4682
Clone Number 2B11
Iso type IgG2a Kappa

Enviar uma mensagem


NUBP1 monoclonal antibody (M03), clone 2B11

NUBP1 monoclonal antibody (M03), clone 2B11