NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004682-B01P
NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NUBP1 protein.
Información adicional
Size 50 ug
Gene Name NUBP1
Gene Alias MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene Description nucleotide binding protein 1 (MinD homolog, E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4682

Enviar uma mensagem


NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

NUBP1 purified MaxPab mouse polyclonal antibody (B01P)