NBL1 monoclonal antibody (M01), clone 2G4
  • NBL1 monoclonal antibody (M01), clone 2G4

NBL1 monoclonal antibody (M01), clone 2G4

Ref: AB-H00004681-M01
NBL1 monoclonal antibody (M01), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NBL1.
Información adicional
Size 100 ug
Gene Name NBL1
Gene Alias D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene Description neuroblastoma, suppression of tumorigenicity 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4681
Clone Number 2G4
Iso type IgG2a Kappa

Enviar uma mensagem


NBL1 monoclonal antibody (M01), clone 2G4

NBL1 monoclonal antibody (M01), clone 2G4