NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004681-D01P
NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
Información adicional
Size 100 ug
Gene Name NBL1
Gene Alias D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene Description neuroblastoma, suppression of tumorigenicity 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4681

Enviar uma mensagem


NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

NBL1 purified MaxPab rabbit polyclonal antibody (D01P)