NARS MaxPab rabbit polyclonal antibody (D01)
  • NARS MaxPab rabbit polyclonal antibody (D01)

NARS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004677-D01
NARS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NARS protein.
Información adicional
Size 100 uL
Gene Name NARS
Gene Alias ASNRS|NARS1
Gene Description asparaginyl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP,IF
Immunogen Prot. Seq MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4677

Enviar uma mensagem


NARS MaxPab rabbit polyclonal antibody (D01)

NARS MaxPab rabbit polyclonal antibody (D01)